Protein Info for PP_5317 in Pseudomonas putida KT2440

Annotation: Probable chorismate pyruvate-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF04345: Chor_lyase" amino acids 11 to 180 (170 residues), 177 bits, see alignment E=2.6e-56 PF01947: Rv2949c-like" amino acids 33 to 177 (145 residues), 25 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to UBIC_PSEPK: Probable chorismate pyruvate-lyase (ubiC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 100% identity to ppf:Pput_5225)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C66 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_5317 Probable chorismate pyruvate-lyase (Pseudomonas putida KT2440)
MSYESPQAAAVAWLPYSQLATDIDQPTLDWLFDEGSLTRRLTRLSIDHFSVTPLFEGWQP
LRDDECQALGIAAGAEGWVREVYLRGHGQPWVFARSVASRSALERGGLDLETLGSRSLGE
LLFCDQAFIRHPLEVCTYPQAWLPSEAAHAALWGRRSRFERNGLDLLVAEVFLPALWQAA
KEENR