Protein Info for PP_5313 in Pseudomonas putida KT2440

Annotation: DNA-binding protein HU-alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF00216: Bac_DNA_binding" amino acids 1 to 89 (89 residues), 104.9 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 84% identical to DBHA_PSEAE: DNA-binding protein HU-alpha (hupA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05787, DNA-binding protein HU-alpha (inferred from 100% identity to ppf:Pput_5222)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C70 at UniProt or InterPro

Protein Sequence (99 amino acids)

>PP_5313 DNA-binding protein HU-alpha (Pseudomonas putida KT2440)
MRKPELAAVIADKADLTKEKANQVLNAILDSITGALDKDTVTLVGFGTFEKRHRGARTGK
NPQTGEPVKIKASNTVAFKPGKNLRDSVNAPAKPAKKGK