Protein Info for PP_5306 in Pseudomonas putida KT2440

Annotation: Biopolymer transport protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 103 to 125 (23 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 93 to 302 (210 residues), 351.5 bits, see alignment E=9e-110 PF01618: MotA_ExbB" amino acids 171 to 285 (115 residues), 111.4 bits, see alignment E=1.3e-36

Best Hits

Swiss-Prot: 90% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to ppu:PP_5306)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C77 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PP_5306 Biopolymer transport protein ExbB (Pseudomonas putida KT2440)
MTRTQPSASPTPSRAWRAIAALTLSLVLAPVAMADEPTTNAATPAAATAPATPAAAPADA
PAPDATASNPAAADPSVQALVEDTSLGMAHDLSPWGMYKNADIVVKIVMIGLAIASIITW
TIWIAKGFELMGAKRRLRGEIAQLKKSTTLKEASEVTNKEGTLAHTLVHDALEEMRLSAN
AREKEGIKERVSFRLERLVHASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIA
KTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLV
SRDLDHQGSERAAPHMVKVG