Protein Info for PP_5297 in Pseudomonas putida KT2440

Annotation: putative Amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 129 to 157 (29 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details amino acids 453 to 475 (23 residues), see Phobius details amino acids 488 to 511 (24 residues), see Phobius details PF13520: AA_permease_2" amino acids 53 to 458 (406 residues), 78.6 bits, see alignment E=4.6e-26 PF00324: AA_permease" amino acids 60 to 476 (417 residues), 47.4 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_5206)

Predicted SEED Role

"amino acid transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C86 at UniProt or InterPro

Protein Sequence (535 amino acids)

>PP_5297 putative Amino acid transporter (Pseudomonas putida KT2440)
MSESEPCTQGLLKQFQNLRQILMSNYTEAGRPPDVAADAGNTQRSKGLAKGRLGLLASVV
LGISTIAPVYTLTGALGPTVREVGAHLPAVFIVGFLPMLLVALGYRELNSAEPDSGTSFT
WSARAFGPMIGWIGGWGLVVATTIVLSNLAGVAVDFFYLFLGQITGKHELAALADNLLIN
IVTCCVFIGLAVWICCRGIATTMTVQYGLVALQLLVLIGFAFAAFGGTTAPPPLAFDFAW
FNPFGVESFSAFAAGLSLSIFIFWGWDTCLTVSEESVGSEEVPGKAATWTVMLILGLYLF
TAIATLQFAGISETGLGLNNPRIQENVFAHLAGPVMGPLAILMSIAVLASTAASLQSTFV
APARTLLAMGYYGAVPQKFASVCPRSQTPRYATICAGLAAGLFYVTMRTLSENVLADTIT
ALGMMICFYYSLTAFACVWYFRGSLFDSLRHFIMRGLCPLLGGVILSVIFVRTAIDSASP
DFGSGSHVGGLGLVFVIAAIISVLGIGLMMLSRMRAPAYFLGATLRQQATLPLQD