Protein Info for PP_5295 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00255: TIGR00255 family protein" amino acids 30 to 316 (287 residues), 311 bits, see alignment E=5e-97 PF03755: YicC-like_N" amino acids 31 to 182 (152 residues), 136.1 bits, see alignment E=1.4e-43 PF08340: YicC-like_C" amino acids 201 to 316 (116 residues), 136.8 bits, see alignment E=4.1e-44

Best Hits

Swiss-Prot: 48% identical to YICC_ECOLI: UPF0701 protein YicC (yicC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_5343)

Predicted SEED Role

"Protein YicC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C88 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PP_5295 conserved protein of unknown function (Pseudomonas putida KT2440)
MGATATLRYNPAPCSREAPTVHSLREVLPMVHSMTAFARVERAGSQGTLVWELRSVNHRY
LEPHLRLPEALRDLEGGVREGLRQGLSRGKVECTLRLNEDSNGKPLKVDHERAAQLVAAA
EEVAGLIKQPAPLNPLEVLSWPGVLVADTSDPQALNAEAMALFDEALAELKAGRQREGQE
LARLINERLDNMASEVTTLRALVPQMLAAQRQKILDRFGDMQAELDPQRLEQEMVLLAQK
SDVAEELDRLSTHVTEVRRVLKGGGAAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVN
LKVLIEQMREQVQNIE