Protein Info for PP_5288 in Pseudomonas putida KT2440

Annotation: Phosphomannomutase/phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 13 to 142 (130 residues), 122.2 bits, E=2.6e-39
• PF02879: PGM_PMM_II
  • amino acids 158 to 255 (98 residues), 103.5 bits, E=1.7e-33
• PF02880: PGM_PMM_III
  • amino acids 260 to 367 (108 residues), 86 bits, E=4.1e-28
• PF00408: PGM_PMM_IV
  • amino acids 375 to 449 (75 residues), 61.8 bits, E=1e-20

Best Hits

Swiss-Prot: 100% identical to ALGC_PSEPK: Phosphomannomutase/phosphoglucomutase (algC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to ppu:PP_5288)

MetaCyc: 78% identical to phosphomannomutase (Pseudomonas aeruginosa)
Phosphomannomutase. [EC: 5.4.2.8]; Phosphoglucomutase. [EC: 5.4.2.8, 5.4.2.2]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucomutase (EC 5.4.2.2)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.2, EC 5.4.2.8)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (7/14 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2, 5.4.2.8

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See Q88C93 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_5288 Phosphomannomutase/phosphoglucomutase (Pseudomonas putida KT2440)
MAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDGRLS
GPMLVEQLIKGLVDAGCNVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFKIV
IAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFKQIVGDVKLAKKLKVVVDCG
NGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADIGLA
FDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQHGGR
ALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTEQSA
ENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEANLTTIDGVRVDYANGWGLV
RASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF