Protein Info for PP_5284 in Pseudomonas putida KT2440

Annotation: UPF0758 protein PP_5284

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF20582: UPF0758_N" amino acids 3 to 79 (77 residues), 85.7 bits, see alignment E=1.9e-28 TIGR00608: DNA repair protein RadC" amino acids 11 to 224 (214 residues), 224 bits, see alignment E=9.6e-71 PF04002: RadC" amino acids 104 to 223 (120 residues), 146 bits, see alignment E=5.1e-47

Best Hits

Swiss-Prot: 100% identical to Y5284_PSEPK: UPF0758 protein PP_5284 (PP_5284) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to ppu:PP_5284)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C97 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PP_5284 UPF0758 protein PP_5284 (Pseudomonas putida KT2440)
MNIREWPAEERPREKLLQRGAGSLTDTELLAVFLGSGVRGCNVVELSRGLLVKFGSLRRL
LEADREAFVGELGLGPVRYSQLQALLEIGRRHLATSIERESAMDSPAAVRRYLKAMLRHE
ASEVFGCLFLDTKHRPLAFEILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGIS
EPSQDDVHLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWIVV