Protein Info for PP_5258 in Pseudomonas putida KT2440

Annotation: L-piperidine-6-carboxylate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 19 to 478 (460 residues), 445.4 bits, E=1e-137

Best Hits

KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 100% identity to ppf:Pput_5168)

MetaCyc: 100% identical to L-aminoadipate-semialdehyde dehydrogenase (Pseudomonas putida)
L-aminoadipate-semialdehyde dehydrogenase. [EC: 1.2.1.31]

Predicted SEED Role

"L-pipecolate dehydrogenase (EC 1.5.99.3)" in subsystem Lysine degradation (EC 1.5.99.3)

MetaCyc Pathways

• L-lysine degradation V (9/9 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• mitochondrial NADPH production (yeast) (4/5 steps found)
• octane oxidation (4/5 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• phytol degradation (3/4 steps found)
• putrescine degradation III (3/4 steps found)
• L-lysine degradation VI (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• L-lysine degradation IX (1/2 steps found)
• L-lysine degradation VIII (1/2 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• serotonin degradation (4/7 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• L-lysine degradation II (L-pipecolate pathway) (5/9 steps found)
• L-lysine degradation XI (2/5 steps found)
• dopamine degradation (2/5 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of L-lysine degradation (23/43 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine biosynthesis
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3, 1.2.1.31

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.31 or 1.5.99.3

Sequence Analysis Tools

See Q88CC3 at UniProt or InterPro

Protein Sequence (496 amino acids)

>PP_5258 L-piperidine-6-carboxylate dehydrogenase (Pseudomonas putida KT2440)
MVAGLLERLGVAAEAYTQGDYPVHTPIDGSQIASVKLLGKAETIARIDQAQSAFEAWRSV
PAPRRGELVRLFGEVLREHKADLGELVSIEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWAWNTALALVAGNSVVWKPSEKTPL
TALACQALFEKALKAFGDAPAGLAQLVIGGREAGEAMVDDPRVPLVSATGSTRMGREVGP
RVAARFGRSILELGGNNAMILAPSADLDLAVRGILFSAVGTAGQRCTTLRRLIVHRSIKD
EVVARVKAAYGKVRIGDPRKDNLVGPLIDKQSFDAMQGALAKARDEGGQVFGGERQLADQ
YPNAYYVSPAIAEMPAQSDVVRHETFAPILYVLAYDDFEEALRLNNEVPQGLSSCIFTTD
IREAERFQSASGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKGYMRRQTNT
VNYSRELPLAQGIVFD