Protein Info for PP_5228 in Pseudomonas putida KT2440

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00652: diaminopimelate epimerase" amino acids 15 to 285 (271 residues), 312.4 bits, see alignment E=1.3e-97 PF01678: DAP_epimerase" amino acids 16 to 136 (121 residues), 111.3 bits, see alignment E=1.6e-36 amino acids 165 to 280 (116 residues), 113.9 bits, see alignment E=2.5e-37

Best Hits

Swiss-Prot: 100% identical to DAPF_PSEPK: Diaminopimelate epimerase (dapF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to ppu:PP_5228)

MetaCyc: 58% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.7

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CF3 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_5228 diaminopimelate epimerase (Pseudomonas putida KT2440)
MLAKACCRSKPMLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRHTGVGFDQLLI
VEAPNNPEVDFRYRIFNADGSEVEQCGNGARCFARFVLDKRLTAKKRIRVETKSGIIVLD
VQNDGQVSVDMGPPRFIPAEIPFVADAQALNYPLEVDGQLHSIAAVSMGNPHAVLRVDDV
QTAPVHELGPKIENHPRFPQRVNAGFIQVIDRHRANLRVWERGAGETQACGTGACAAAVA
AISQGWMDSPVSLDLPGGRLHIEWAGPGKPVMMTGPAVRVYEGQVRL