Protein Info for PP_5221 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function, UPF0178 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF02639: DUF188" amino acids 30 to 158 (129 residues), 135.7 bits, see alignment E=4e-44

Best Hits

Swiss-Prot: 100% identical to Y5221_PSEPK: UPF0178 protein PP_5221 (PP_5221) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09768, hypothetical protein (inferred from 100% identity to ppf:Pput_5130)

Predicted SEED Role

"probable P23 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CG0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PP_5221 conserved protein of unknown function, UPF0178 family (Pseudomonas putida KT2440)
MMGALSSCRECPMRVWIDADACPKAAKDLIVKFALKRKFEVVMVAGQAVAKPAFAIVRLI
VVPSGMDAADDYIVEHAVPGELVICSDVPLADRLVKKGVAALDPRGREFDERNMGDRLAA
RNLFTELREQGQVGGGQAAYGEREKQAFANALDRIIARLSKG