Protein Info for PP_5211 in Pseudomonas putida KT2440

Annotation: ChaC-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04752: ChaC" amino acids 13 to 173 (161 residues), 100.4 bits, see alignment E=6.2e-33

Best Hits

KEGG orthology group: K07232, cation transport protein ChaC (inferred from 99% identity to ppf:Pput_5120)

Predicted SEED Role

"ChaC-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CH0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_5211 ChaC-related protein (Pseudomonas putida KT2440)
MKTTMSRHQGGPVWLFAYASLIWRPECNSVERQRARVHGYHRGLYLWSHEHRGTPETPGL
VFGLDRGGSCSGFAYRLDERNLDDSLMALWQREMPYPAYRPHWLNCRLGDGSKVQALGFV
LERHLPCYAGNLPDTLLSQILASAKGRYGTTREYVEQTLNALRSHQMPDRNLEARFRRCH
NLREV