Protein Info for PP_5208 in Pseudomonas putida KT2440

Annotation: putative translation related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 218 to 221 (4 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 361 (337 residues), 143.7 bits, see alignment E=1.2e-45 PF12679: ABC2_membrane_2" amino acids 142 to 366 (225 residues), 55.4 bits, see alignment E=8.7e-19 PF01061: ABC2_membrane" amino acids 179 to 334 (156 residues), 101.1 bits, see alignment E=9.6e-33

Best Hits

Swiss-Prot: 49% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to ppf:Pput_5116)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CH3 at UniProt or InterPro

Protein Sequence (370 amino acids)

>PP_5208 putative translation related protein (Pseudomonas putida KT2440)
MSRLNHTLRLGLKELTSLRHDSVLLLFLLYAFSVAIYMPAAGSVIGVHNASVAVVDEDHS
LLSRKLSEALQPPEFQPAVPLPPQRLDQAMDSGQYTFVINVPVNFQSDLLAGRSPELQIN
VDATAMSQAFMGAGYIGRIFERELLDYSQRGNEQSPVLINPKALFNPNLEGGWFLAVIQI
VNNITILAIILTGTALLREREHGTLDHLLVLPLTALEIMLAKIGSNALVVVICTWISLVV
VVKGALGVPLSGSMGLFLAVTALYLFASTSLGIFLATLARSTPQFGLLAIPVIIPMLLLS
GGSTPLDSMPQWLQWVMQGSPSTHFVSLSAAILFRDAGWAVVWPDILALTLIGLVFFSVA
LARFRRSLAS