Protein Info for PP_5206 in Pseudomonas putida KT2440

Annotation: putative translation-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF16576: HlyD_D23" amino acids 46 to 271 (226 residues), 43.7 bits, see alignment E=3.1e-15 PF13533: Biotin_lipoyl_2" amino acids 49 to 94 (46 residues), 42.4 bits, see alignment 7e-15 PF13437: HlyD_3" amino acids 187 to 300 (114 residues), 43.9 bits, see alignment E=5.4e-15

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 99% identity to ppf:Pput_5114)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CH5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PP_5206 putative translation-related protein (Pseudomonas putida KT2440)
MNRYAPRIFATALIALLAAAGGLGYWKSLHDQLPEGLSMGNGRLEATEVQIASKIPGRLA
EVLVDEGDNVIRGQLLARIDTRTMEAQRSQAEAEVLRARENYAAAQASVQLRQSELLLAS
QELKRVREIFQRKFASQQLLDQQQARFDTANAAVVAARAQLAAIKAAIGAAEAQVAQLTS
EIDDSSLRAPINGIIQLRLAEPGEVLGAGGRVLMLIDPSDQYMNLYLPASTSGRLTVGDQ
ARIVLDALPERALPAKVAFVAAKAQFTPKQVETRDERQKLVFRVKLRLSDPGAVPQAKPG
MPGAGYVRTAEVDWPANLQ