Protein Info for PP_5199 in Pseudomonas putida KT2440

Annotation: 2-octaprenyl-6-methoxyphenyl hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase" amino acids 5 to 388 (384 residues), 453.2 bits, see alignment E=6.6e-140 PF01494: FAD_binding_3" amino acids 5 to 337 (333 residues), 81.8 bits, see alignment E=5.7e-27 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 6 to 388 (383 residues), 423.5 bits, see alignment E=7.1e-131

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to ppu:PP_5199)

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CI2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PP_5199 2-octaprenyl-6-methoxyphenyl hydroxylase (Pseudomonas putida KT2440)
MSRVNLAIIGGGLVGASLALALQAGARARGWKILLIEPFAPGDSYQPSYDARSSALSFGT
QQIYQQLGLWQAIGRRAEPIRQIHVSDRGRFGATRLDALEEGVPALGYVVENAWLGQCLW
QGLDSEVVSWRCPAEVTSMQAIERGYRLRLNDDTQLECDLAVLADGGRSGLREQLGIHVR
HTPYQQSALIANITPGEAHGGQAFERFTEEGPMALLPLPENRCALVWTRQGMDARRLADI
DERSFLRELQGVFGYRLGALRQVGARHLYPLSLIEAQEQVRPHLVVLGNAAHSLHPIAGQ
GFNLSLRDVQALAEALLAGPQQPGDLTTLQAYHQRQRLDQAMTIGFSDQVTRLFGSNQPL
LTAGRNLGLLGLDLLPPAKSWFARQAMGLGTRPDPRGQA