Protein Info for PP_5186 in Pseudomonas putida KT2440

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 10 to 373 (364 residues), 382.4 bits, see alignment E=1.1e-118 PF01546: Peptidase_M20" amino acids 73 to 375 (303 residues), 103.9 bits, see alignment E=1.1e-33 PF07687: M20_dimer" amino acids 174 to 278 (105 residues), 82 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 50% identical to ARGE_ENT38: Acetylornithine deacetylase (argE) from Enterobacter sp. (strain 638)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 100% identity to ppu:PP_5186)

MetaCyc: 50% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CJ5 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_5186 acetylornithine deacetylase (Pseudomonas putida KT2440)
MPLPTLKDQFAALIAAPSVSCTQPALDQSNRQVIDLLAGWLGDLGFKCDIQQVSPGKFNL
LASRGTGPGGLVLAGHSDTVPYDEQLWASDPLKLIETDGRWVGLGSCDMKGFFALVIEAV
IPLLEHDFKEPLLILATCDEESSMSGARALAEAGQPLGRAAILGEPTGLRPIRMHKGILM
DRIDILGRSGHSSDPSLGRSAMEAMHAVMGELMGLRQQWQQTYSNPQFTVPTPTMNFGCI
HGGDNPNRICGQCALEFDLRPLPGMDVDQLRAAIREKLVLVAERHEVRIDYAPLFPEVPP
FEQAADVELVQVAERLTGHRAEAVAFGTEAPYLQQLGCQTIVLGPGDIACAHQPGEYLEM
SRIEPTVRLLRDLIRHYCLH