Protein Info for PP_5175 in Pseudomonas putida KT2440

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 33 to 350 (318 residues), 224.9 bits, see alignment E=6.4e-71 PF25917: BSH_RND" amino acids 60 to 192 (133 residues), 33.6 bits, see alignment E=7.3e-12 PF25876: HH_MFP_RND" amino acids 98 to 167 (70 residues), 38 bits, see alignment E=4.1e-13 PF25967: RND-MFP_C" amino acids 287 to 342 (56 residues), 37.8 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5175)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CK5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PP_5175 HlyD family secretion protein (Pseudomonas putida KT2440)
MALMRPLSVVCLGLLYMLTGCSKEEVPETLPRVGVQQVQPTDFAARVTLTGDVQARVQTD
LSFRVGGKIISRSVDVGDHVKANQVLARLDPKDLQNNVDSAKAEVFAAQARVTQTSAAFV
RQQKLLPKGYTSQSEYDAAEAALRSNQSALKAAQAQLANANEQLSYTALVSEAAGVITER
QAEVGQVVQATMPIFSLAVDGDRDAVFNVYESLLVAPPSDAGVVVSLLDDPKVQAHGFVR
EITPTVSAQSGTVQVKVGLKDVPPGMQLGAPVTATTNAQGRPSIELPWSALTKALHEPAV
WVVGEGDKVELRKVEIRRYLTGKIVVASGLKGGETVVVNGGQLLHPGMQVLKVDAKGPGG
EL