Protein Info for PP_5142 in Pseudomonas putida KT2440

Annotation: Prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 233 to 259 (27 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 4 to 263 (260 residues), 290.2 bits, see alignment E=8.4e-91 PF01790: LGT" amino acids 9 to 257 (249 residues), 283.3 bits, see alignment E=7.4e-89

Best Hits

Swiss-Prot: 100% identical to LGT_PSEPK: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to ppu:PP_5142)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CN8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_5142 Prolipoprotein diacylglyceryl transferase (Pseudomonas putida KT2440)
MLPYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRLNRFDPTWNREKLSDLVFWL
SMGVIVGGRLGYVLFYDLHAYLANPTLIFEVWKGGMSFHGGFIGVMLAALWFGKRNNKSF
FELMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMIFPPFSDPAQLPRHPSQLYQF
ALEGVALFVILWLFSRKPRPTMAVSGMFSLCYGIFRFAVEFVRVPDAQLGYIAFGWLTQG
QLLCIPMIVGGLVLIWWAYNRKPTAKPA