Protein Info for PP_5135 in Pseudomonas putida KT2440

Annotation: ABC transporter, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 7 to 336 (330 residues), 532.2 bits, see alignment E=2.4e-164 PF13531: SBP_bac_11" amino acids 26 to 283 (258 residues), 50.4 bits, see alignment E=5.3e-17 PF01547: SBP_bac_1" amino acids 33 to 278 (246 residues), 55.6 bits, see alignment E=1.8e-18 PF13416: SBP_bac_8" amino acids 40 to 279 (240 residues), 73.2 bits, see alignment E=6.5e-24 PF13343: SBP_bac_6" amino acids 91 to 307 (217 residues), 82 bits, see alignment E=9.9e-27

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to ppu:PP_5135)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CP5 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PP_5135 ABC transporter, periplasmic binding protein (Pseudomonas putida KT2440)
MHKHLALAVAVSAVFSLQASAADTQLTVYTALEAEQLKTYKQAFEKANPDIEIKWVRDST
GIITAKLLAEKERPQADAVWGLAASSLAILDQNGMLEAYAPKDLGKISGNYRDAANPPAW
VGMDVWAATICFNTIEAEKQGLSKPVSWQDLTKPEYKGKIVMPNPASSGTGFLDVSAWLQ
TFGEPQGWAYMDALHQNIGQYVHSGSKPCKLAAAGEFPIGISFEYPAVQLKRQGAPLDIV
LPKEGLGWEIEATAVIKGSPKADVAKRLADFSASPAAMELYKENFAVLAAPGIAKPQTEL
PADYEQRLIKNDFVWASKNRDQILAEWRKRYDGKSEKVAQQ