Protein Info for PP_5133 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 76 to 97 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 174 to 200 (27 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details PF11067: DUF2868" amino acids 150 to 447 (298 residues), 360.9 bits, see alignment E=3.7e-112

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5133)

Predicted SEED Role

"probable integral membrane protein NMA1899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CP7 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_5133 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MEDLVTAPTPLDKRWLTEAVRLREEHAGPLEDQEANRHARQLGGDLATRIETRALFLAER
DDMTGALRHWKQGARLALLALLLMAVLSGTGLGLAALGDGQRPVNVFWALGSLLGLNLLM
LLGWGMGFALSGEHGAGLGRLWLWLSERFARDAKAAHLAPALLVLLQRQRLNRWLLGLLV
HGLWLLAMLTALGMLLVLLATRRYGFVWETTLLAADPFIHLTQALGALPSLLGFAVPDEA
MIRASGDSLPALDVARQAWASWLLGVVLVYGLLPRLLLAGLCLWRWRQGRERLTLDLGLP
GYAQLREALMPRSERIGVQDAAPQALPQFAAGQLESGSSGALLVGLELDDQRPWPPALPK
SVTDAGVLDSRESRNRLLEQLSRFPPARLAIACDPRRSPDRGSLALLAELARNAGATRIW
LLQAAPGQPLDAERLGDWHEALDRLGLQHADTSPLTWLEHGHD