Protein Info for PP_5110 in Pseudomonas putida KT2440

Annotation: cytokinetic ring ABC transporter-like subunit - ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR02673: cell division ATP-binding protein FtsE" amino acids 3 to 216 (214 residues), 282.6 bits, see alignment E=1.1e-88 PF00005: ABC_tran" amino acids 20 to 167 (148 residues), 120 bits, see alignment E=1.2e-38 PF13304: AAA_21" amino acids 115 to 202 (88 residues), 37.3 bits, see alignment E=3.2e-13

Best Hits

Swiss-Prot: 55% identical to FTSE_SHIFL: Cell division ATP-binding protein FtsE (ftsE) from Shigella flexneri

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 99% identity to ppw:PputW619_0355)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CS0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PP_5110 cytokinetic ring ABC transporter-like subunit - ATP-binding subunit (Pseudomonas putida KT2440)
MTMIRFEQVAKRYPNGHVGLHELSFRARRGEFLFVTGHSGAGKSTLLRLLLAMERPTSGK
LMLAGQDLGQISNAQIPFLRRQIGVVFQNHQLLFDRTVFNNIALPLQILGLSKVEIAKRV
DSALERVSLSDKGELFPADLSTGQQQRVGIARAIVHQPALLLADEPTGNLDPRLAAEIMG
VFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRLIGDGEAGQ