Protein Info for PP_5107 in Pseudomonas putida KT2440

Annotation: Monofunctional biosynthetic peptidoglycan transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details TIGR02070: monofunctional biosynthetic peptidoglycan transglycosylase" amino acids 5 to 222 (218 residues), 328.5 bits, see alignment E=9.4e-103 PF00912: Transgly" amino acids 54 to 218 (165 residues), 165.5 bits, see alignment E=4.4e-53

Best Hits

Swiss-Prot: 100% identical to MTGA_PSEPK: Biosynthetic peptidoglycan transglycosylase (mtgA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 100% identity to ppf:Pput_4980)

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CS3 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PP_5107 Monofunctional biosynthetic peptidoglycan transglycosylase (Pseudomonas putida KT2440)
MLSTLIRRLSRALLWFVAGSIVLVLVFRWVPPPGTALMVERKVQSWVNGEPIDLQRDWEP
WENISDELKVAVIAGEDQKFASHWGFDLPAIQAALAHNERGGNIRGASTLTQQVAKNLFL
WSGRSWFRKGLEAWFTALIELFWSKERILEVYLNSAEWGKGVFGAQAAARYHFGVDASRL
SRQQAAQLAAVLPSPIKWSASRPSAYVASRAGWIRRQMSQLGGPSYLMQLDSSRKL