Protein Info for PP_5106 in Pseudomonas putida KT2440

Annotation: conserved inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details PF04241: DUF423" amino acids 19 to 105 (87 residues), 97.4 bits, see alignment E=2.4e-32

Best Hits

Swiss-Prot: 41% identical to Y2132_STAS1: UPF0382 membrane protein SSP2132 (SSP2132) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 98% identity to ppg:PputGB1_5156)

Predicted SEED Role

"COG2363"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CS4 at UniProt or InterPro

Protein Sequence (123 amino acids)

>PP_5106 conserved inner membrane protein (Pseudomonas putida KT2440)
MLRSFLMLAAFFGFTGVALGAFAAHGLKNRLTADYLAIFHTGVTYQLVHALAIFGVAVLS
AHLPGRLVGWAGGLFALGIVLFSGSLYLLTLSGLGKLGIITPIGGLCFLVGWLCLGLAAW
RLG