Protein Info for PP_5094 in Pseudomonas putida KT2440

Annotation: putative enzyme with PLP binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 223 (223 residues), 256.8 bits, see alignment E=9.1e-81 PF01168: Ala_racemase_N" amino acids 7 to 223 (217 residues), 102.5 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 80% identical to PLPHP_PSEAE: Pyridoxal phosphate homeostasis protein (PA0394) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06997, (no description) (inferred from 100% identity to ppu:PP_5094)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CT6 at UniProt or InterPro

Protein Sequence (228 amino acids)

>PP_5094 putative enzyme with PLP binding domain (Pseudomonas putida KT2440)
MSTLADNLSAISARIASAAQAVGRDPASVQLLAVSKTKPASAIREIHAAGVHDFGENYLQ
EALTKQQALSDLPLIWHFIGPIQSNKTKAIAEHFDWVHSVDRLKIAQRLSEQRPAGLAPL
NICLQVNVSGEDSKSGCTPADLPALAKAVAALPNLRLRGLMAIPEPTEDRATQEAAFASL
RKLQEGLGLGLDTLSMGMSHDLEAAIAQGATWVRIGTALFGARDYGNT