Protein Info for PP_5081 in Pseudomonas putida KT2440

Annotation: Type IV pili biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF04350: PilO" amino acids 49 to 186 (138 residues), 38.8 bits, see alignment E=1e-13 PF04351: PilP" amino acids 229 to 302 (74 residues), 48.5 bits, see alignment E=9.5e-17

Best Hits

KEGG orthology group: K02664, type IV pilus assembly protein PilO K02665, type IV pilus assembly protein PilP (inferred from 100% identity to ppu:PP_5081)

Predicted SEED Role

"Type IV pilus biogenesis protein PilO / Type IV pilus biogenesis protein PilP" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CU9 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PP_5081 Type IV pili biogenesis protein (Pseudomonas putida KT2440)
MSPAQMLAWLAVVEGSGRFRWLAPALIAVVLFSLGCAMRLPALLQQQAREDARHVELNQL
QAANAAQLAELERLKALVVIAEQRLQEAHWYLAAGESMSDLLERLAVSGHAHGLLVERLD
VEAGEQQAGFSKVPLVVQVVGRYPALRLWLDDWLGQARILRSGDMSLATVDRQPGLLRLQ
LRVDAYHTATPVKAPAMLAHLPARAAMAAPEVDPFAPAAARVASAGLVGVPLAQLEMVGS
LARGAAREALLMAAGKLYRVRPGDRVGRDQGVVMHIDQRQVEVRERLFMAGVWHERTAFI
TLTKRLGKEALDPNENVDEIPVGDPAVDPAGFGDALPG