Protein Info for PP_5066 in Pseudomonas putida KT2440

Annotation: K(+)/H(+) antiporter NhaP2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 314 to 339 (26 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 38 to 404 (367 residues), 198.2 bits, see alignment E=3.1e-62 PF02080: TrkA_C" amino acids 434 to 499 (66 residues), 49.2 bits, see alignment E=6e-17 PF03471: CorC_HlyC" amino acids 512 to 585 (74 residues), 46.3 bits, see alignment E=5.3e-16

Best Hits

Swiss-Prot: 100% identical to NHAP2_PSEPK: K(+)/H(+) antiporter NhaP2 (nhaP2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to ppf:Pput_4939)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CW4 at UniProt or InterPro

Protein Sequence (597 amino acids)

>PP_5066 K(+)/H(+) antiporter NhaP2 (Pseudomonas putida KT2440)
MLNALPRPFPAVSEYLPLDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGM
LAGVDGGGIIFNNYPTAYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITT
ALTGLIAAWLFNLSLIQGLLIGAIVGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPM
AVFLTVTLIDMIASGETGLHWSLLGHLLREFGIGTLLGLGGGWLMLQLVNRINLAGGLYP
ILVVAGGLVMFSLTNALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFL
VLGLLVTPHDLLPIALPALGLALWMILVARPLSVVAALLPFKAFHGREKGFISWVGLRGA
VPIILAVFPLMAGLPDAQLFFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPDPAPISRS
ALEVHITSEWEMFVYRLGAEKWCIGAALRELKMPEGTRIAALFRGEQLLHPSGSTVLEVG
DMLCVIGHEHNLPALGKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLDAK
MPLAQFIRQKVGGAPVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGPGLFL