Protein Info for PP_5061 in Pseudomonas putida KT2440

Annotation: Choline transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details amino acids 484 to 506 (23 residues), see Phobius details PF02028: BCCT" amino acids 20 to 512 (493 residues), 569.4 bits, see alignment E=2.8e-175 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 58 to 512 (455 residues), 498 bits, see alignment E=1.2e-153

Best Hits

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 100% identity to ppu:PP_5061)

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CW9 at UniProt or InterPro

Protein Sequence (667 amino acids)

>PP_5061 Choline transporter (Pseudomonas putida KT2440)
MSSASLTKPPAERVRVNRVVFFTSALMILVLTALLIAVPETAGQVLGVAQKWLTRTFGWY
YMLVICGYLLFVVYLAFSDYGSLKLGGKDDQPDFSYGAWAGMLFSSGIGISLLYFGASEP
LDHYFNPPEGTPASLEAARQGLQLTFLHWGLHGWAIYALVGLAVGYFAYRHNQPLALRSA
LYPLVGERWVKGAAGNAVDIFGMFVTLLGLVTNLGIGAMQVSSGLEYLFGMDHSKTNLLV
VILVMAGVATVAAVSGVENGIRRLSNLNIMLFSGLLIFVLLGGETLHLLNGFVQNVGDYL
NGIVLKTFDLYVYEGEAGKSERWLGLWTVFYWAWWISWGPFVGMFIARISKGRTVRQLVM
GVLLIPLGFTLAWLSIFGNTALDLVINQGAVELGKTALEQPSMSIYQLLEHFPAAKIVIG
VAVFVGFVLFLTPADSGAVMMANLSCTGGKVDEDAPHWMVVFWSVVITLVTIGLLFAGNF
EAMQTMVVLAGLPFSVVLVLFMFGLYKAMKQDVVIEQERAELAARGRRGFSERLTQLELQ
PTQAVVQRFMDKQVSPALKEAAAQLQTQGFEVETRVGQSRNLMGLRVMMEEGNPFVYEVS
LDGYMAAPSEAPVEGEPELRQRFYRAEVYLHDGSQEYDLMGFAPDQIVRDVLDQFESHRQ
VLGRVYS