Protein Info for PP_5037 in Pseudomonas putida KT2440

Annotation: lipocalin family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08212: Lipocalin_2" amino acids 35 to 181 (147 residues), 206.8 bits, see alignment E=7.2e-66

Best Hits

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to ppf:Pput_4911)

Predicted SEED Role

"Outer membrane lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CZ2 at UniProt or InterPro

Protein Sequence (190 amino acids)

>PP_5037 lipocalin family lipoprotein (Pseudomonas putida KT2440)
MRRAYLLMGVCLALLLGGCAGSVHDPLAPKTAGHVDLKRYQGKWYELARLPMRFQEGCEQ
SEAHYNLRPDGSYGVLNRCRTMGDEWLRAEGHANIQEPGHTDKLWVEFDNWFTRLVPGVA
RGEYWILYVDEHYRTAIVGSPDRKYLWILSRTPTLPAWERENLLSRARQQGYDTSRLIWR
ASDQQIVKMH