Protein Info for PP_5035 in Pseudomonas putida KT2440

Annotation: Histidine utilization repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR02018: histidine utilization repressor" amino acids 19 to 247 (229 residues), 362.3 bits, see alignment E=4.5e-113 PF00392: GntR" amino acids 20 to 83 (64 residues), 72 bits, see alignment E=2.6e-24 PF07702: UTRA" amino acids 104 to 241 (138 residues), 137.2 bits, see alignment E=3.5e-44

Best Hits

Swiss-Prot: 98% identical to HUTC_PSEPU: Histidine utilization repressor (hutC) from Pseudomonas putida

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 99% identity to ppf:Pput_4909)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88CZ4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PP_5035 Histidine utilization repressor (Pseudomonas putida KT2440)
MPTPPVSVLVAQMGEGPAPLYARVKQMIIQQIDNGSWPPHHRVPSESELVNELGFSRMTI
NRALRELTAEGLLVRMQGVGTFVAEPKGRSALFEVNNIADEIAARGHQHSCQVITLAEEA
AGSERALALDMREGQRVFHSLIVHFENGVPVQIEDRYVNAAIAPDYLKQDFTRQTPYAYL
SQVAPLTEGEHVVEAILAEPEECTLLQIDRGEPCLLIRRRTWSGRQPVTAARLIHPGSRH
RLEGRFSK