Protein Info for PP_5023 in Pseudomonas putida KT2440

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 117 to 211 (95 residues), 94.6 bits, see alignment E=2.1e-31 PF00528: BPD_transp_1" amino acids 136 to 317 (182 residues), 92.8 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4897)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D06 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PP_5023 Amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MIKHKKAQWPWHGLTALVLVGLALSLYMATSMISYEWRWNRVPQYFAYKAEETQRAAGYG
TVQEIVISGDNARVTLKDESGAEQVLDVDKDSLQLSRGDDVAEGDQIGVTRHWAAGPLAW
GLWTTLWISVVSGALGLVIGLFAGLCRLSNNPTLRDLSTVYVELVRGTPLLVQIFIFYFF
IGTVLNLSREFAGVAALALFTGAYVAEIVRAGVQSIAKGQNEAARSLGLNAGQSMRHVIL
PQAFKRVLPPLAGQFISLVKDTSLVSVIAITELTKSGREAITTSFSTFEIWFCVAGLYLL
INLPLSHIASRLERRLAQSD