Protein Info for PP_5022 in Pseudomonas putida KT2440

Annotation: Glutamine transport ATP-binding protein GlnQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00005: ABC_tran" amino acids 22 to 169 (148 residues), 136.8 bits, see alignment E=7.7e-44 PF13304: AAA_21" amino acids 128 to 200 (73 residues), 29.8 bits, see alignment E=6e-11

Best Hits

Swiss-Prot: 63% identical to GLNQ_BACSU: Glutamine transport ATP-binding protein GlnQ (glnQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to ppg:PputGB1_5072)

MetaCyc: 62% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D07 at UniProt or InterPro

Protein Sequence (244 amino acids)

>PP_5022 Glutamine transport ATP-binding protein GlnQ (Pseudomonas putida KT2440)
MIEVRDLLKVFDTRGQVVRAVDNVTTQVAKGEVVVVLGPSGSGKSTFLRCLNGLEHFDQG
HVAIDGLQLADPKTDINAYRREVGMVFQHFNLFPHMTVLENLCLAQKVVRKRNKADREAK
ARALLEKVGISQKANEYPSRLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPEMVGEVL
DVMKTLAQEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDSAPAAFFAAPKDPRAQAFL
RQVL