Protein Info for PP_5014 in Pseudomonas putida KT2440
Annotation: Phosphoribosyl-AMP cyclohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HIS3_PSEP1: Phosphoribosyl-AMP cyclohydrolase (hisI) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 99% identity to ppg:PputGB1_5064)Predicted SEED Role
"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- L-histidine biosynthesis (10/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Histidine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.19
Use Curated BLAST to search for 3.5.4.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88D15 at UniProt or InterPro
Protein Sequence (130 amino acids)
>PP_5014 Phosphoribosyl-AMP cyclohydrolase (Pseudomonas putida KT2440) MKDWLDEIKWNSDGLVPAIAQDHKTGRVLMMAWMNRESLALTAAEQRAIYWSRSRGKLWR KGEESGHVQKLHELRLDCDADVIILMVEQLGHIACHTGRESCFYRVYEDGQWKIVDPVLK DPDAIYSAGH