Protein Info for PP_5013 in Pseudomonas putida KT2440

Annotation: 2-octaprenylphenol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 492 to 512 (21 residues), see Phobius details amino acids 518 to 538 (21 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 447 (441 residues), 583.4 bits, see alignment E=1.2e-179 PF03109: ABC1" amino acids 96 to 344 (249 residues), 266.2 bits, see alignment E=3.3e-83 PF27536: UbiB_N" amino acids 364 to 425 (62 residues), 106.6 bits, see alignment E=5.8e-35 PF27517: UbiB_C" amino acids 494 to 539 (46 residues), 59.4 bits, see alignment 4.1e-20

Best Hits

Swiss-Prot: 100% identical to UBIB_PSEP1: Probable protein kinase UbiB (ubiB) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to ppf:Pput_4887)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWS4 at UniProt or InterPro

Protein Sequence (540 amino acids)

>PP_5013 2-octaprenylphenol hydroxylase (Pseudomonas putida KT2440)
MKLLAVRRLFRIQRVVIRYRLDDLLFDQPLLPWWLASLRLLMPWRWLPRKPTELSRGARL
RLALQDLGPIFIKFGQLLSTRRDLLPPDIADELMLLQDRVPPFDPTQAVALIEEQLGAKV
GEVFSRFDVEPLASASVAQVHAARLKTGEEVVVKVVRPGLKPVIAQDLAWLFLIAKAAER
ASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEDSELMYVPQVYWDLCRPK
VLVMERIYGVPVTDMATLADQRTDMKLLAERGVEVFFTQVFRDSFFHADMHPGNIFVSTV
KPWSPQYIAIDCGIVGSLTAEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPANTKVNEF
EAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQL
YPDLDLWSTAKPYLERWMRDRYSPKAVFGNLHSQVEQLPHLAGMTRDLLERLSQPHLHDP
QLPERRRQGDRWALRLLGAGLLGGGAVLAAGAAETASLAAPAAWPAWLMLAAGLYLIVRQ