Protein Info for PP_4998 in Pseudomonas putida KT2440

Annotation: Aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02729: OTCace_N" amino acids 19 to 163 (145 residues), 149.3 bits, see alignment E=8.9e-48 TIGR00670: aspartate carbamoyltransferase" amino acids 19 to 319 (301 residues), 295.2 bits, see alignment E=2.5e-92 PF00185: OTCace" amino acids 171 to 317 (147 residues), 82.2 bits, see alignment E=4.4e-27

Best Hits

Swiss-Prot: 100% identical to PYRB_PSEP1: Aspartate carbamoyltransferase (pyrB) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 99% identity to pen:PSEEN5061)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D30 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PP_4998 Aspartate carbamoyltransferase (Pseudomonas putida KT2440)
MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADMFVV
RHSDSGAAHFIAEHVCPEVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVYTDLAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGKHSVI
LNQVTYGIAVRMAVLSMAMSGQNAQRQLDQENAQ