Protein Info for PP_4989 in Pseudomonas putida KT2440

Annotation: Protein PilJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF13675: PilJ" amino acids 43 to 152 (110 residues), 102 bits, see alignment E=2.1e-33 PF00015: MCPsignal" amino acids 462 to 646 (185 residues), 147 bits, see alignment E=5.3e-47

Best Hits

Swiss-Prot: 76% identical to PILJ_PSEAE: Protein PilJ (pilJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 100% identity to ppu:PP_4989)

Predicted SEED Role

"twitching motility protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D39 at UniProt or InterPro

Protein Sequence (686 amino acids)

>PP_4989 Protein PilJ (Pseudomonas putida KT2440)
MNKPATPVTATTVSPRTRSIAQITVLFLILILSIILLFANFAYLNTQSNYDKQYIGHAGE
LRVLSQRIAKNATEAATGKALAFKLLSDARNDFERRWGYLRQGDKSTGLPPAPPAVRDEM
ESVRRDWENLRKNTDIILASEQTVLSLHQVAATLAETVPQLQVEYEKVVEILLQSGAPAN
QVAVAQRQLLLAERILGSVNTVLAGDDSAAQAADAFGRDAGRFGQVLEGMINGNATIQVT
RVEDADARARLAEIAELFQFVAGSVDEILETSPELFRVREAAGNIFSLSQTLLDEASHLA
NGFENLAGGRTLDTVGGYVLGLLALASIILIGLVMVRTTNRQLRETAEKNERNQQAIMRL
LDEIEELADGDLTVTVSVTEDFTGAIADSINYSVDQLRDLVATINHSAVQVAAAVQDTQN
TARQLAKASEHQAAQISEASEAVGDMVESIDRVSAHAYESAKVAERSVAIANKGNEVVHN
TINGMDNIREQIQDTAKRIKRLGESSQEIGDIVSLIDDIADQTNILALNAAIQASLAGEA
GRGFAVVADEVQRLAERSSSATRQIEALVRTIQADTNEAVISMEQTTAEVVRGARLAQDA
GVALAEIEGVSQNLADLIHSISDAAQLQTSSAGQISHTMAVIQQITAQTSAGSGATADSI
RHLARMASEMRRSVSGFTLPPPTEPR