Protein Info for PP_4986 in Pseudomonas putida KT2440

Annotation: Channel protein, hemolysin III family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF03006: HlyIII" amino acids 5 to 197 (193 residues), 155.5 bits, see alignment E=8.6e-50 TIGR01065: channel protein, hemolysin III family" amino acids 5 to 204 (200 residues), 214.6 bits, see alignment E=5.1e-68

Best Hits

Swiss-Prot: 39% identical to YQFA_SHIFL: UPF0073 inner membrane protein YqfA (yqfA) from Shigella flexneri

KEGG orthology group: K11068, hemolysin III (inferred from 99% identity to ppf:Pput_4860)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D42 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PP_4986 Channel protein, hemolysin III family (Pseudomonas putida KT2440)
MYYGERFNAWTHLVGAVLAAIGAIWLIVAAGLQGDPWKIVSFSIYGGTLLLLYSISTLYH
STRGRAKVIMRKLDHLSIYLLIAGSYTPFCLVSLRGPWGWSLFGVVWGLAIIGMLQEIKP
RSEARILSIIIYAVMGWIVLVAVKPLLNSLGTAGFAWLAAGGVFYTVGIIFFAFDSRFRH
WHGIWHLFVIAGSLMHFVAVSLYVR