Protein Info for PP_4983 in Pseudomonas putida KT2440

Annotation: putative amine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 30 to 69 (40 residues), 28.7 bits, 2.8e-10
• PF01266: DAO
  • amino acids 31 to 272 (242 residues), 51.6 bits, E=3.7e-17
• PF13450: NAD_binding_8
  • amino acids 32 to 66 (35 residues), 35.1 bits, see alignment (E = 4.5e-12)
• PF01593: Amino_oxidase
  • amino acids 37 to 451 (415 residues), 163.4 bits, E=4e-51

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 100% identity to ppu:PP_4983)

Predicted SEED Role

"Amine oxidase [flavin-containing] (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• superpathway of phenylethylamine degradation (11/11 steps found)
• phenylethylamine degradation I (2/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• putrescine degradation III (3/4 steps found)
• salidroside biosynthesis (3/4 steps found)
• L-tryptophan degradation VI (via tryptamine) (2/3 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (6/9 steps found)
• phenylethanol biosynthesis (3/5 steps found)
• serotonin degradation (4/7 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See Q88D45 at UniProt or InterPro

Protein Sequence (619 amino acids)

>PP_4983 putative amine oxidase (Pseudomonas putida KT2440)
MAAAWVRLCALVLIGVSSGAALAKDKTPTAIVVGGGLAGLTAAYELQNKGWQVTLLEAKA
GMGGRSGLATSEWIGNAKAQPVLNQYLDRFKLETLPAPEFVRTPGYLIDGEYFSASDLAT
KQPATAEALKRYEKTLDDLARSIDDPLNPQATSTLFALDQINVSTWLDKLQLPATARQLI
NQQIRTRYDEPSRLSLLYFAQQNRVYRGVSDRDLRAARLPGGSPVLAQAFVKQLKTIKTN
SPVTAIVQDKDGVTVKVGSVGYKADYLVMAVPLRALAKIQMTPGLDSQHLAALKGTNYGW
RDQIMLKFKKPVWESRARMSGEIYSNAGLGMLWVEPALKGGANVVINLSGDNARLLQAFG
EKQMVDQVLIRLHAFYPQARGAFTGYEVKRYSADAGTGGAYLAYGPGQISKYWRLWERPV
QRMTFAGEHTDALYPGTLEGALRSGQRAASQAQDLLAGKSFDPAKALPVAAAAGAAAAKE
SKGGFFSNMFGGSSDKGDKADKAPAKAEPKQTEEAKQDKPGFFKRLFGGAQAPEAKVEPI
AKAEEVAPAPAPAPQAAPAPAAPAPVAKETAAKPAATKAAPAKHAPVHKPAHKPAETKKA
TAKSEPAKKPVTNTQAKAG