Protein Info for PP_4976 in Pseudomonas putida KT2440

Annotation: Adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF05221: AdoHcyase" amino acids 7 to 144 (138 residues), 238.2 bits, see alignment E=1.2e-74 amino acids 144 to 463 (320 residues), 170 bits, see alignment E=6.7e-54 TIGR00936: adenosylhomocysteinase" amino acids 8 to 456 (449 residues), 503.9 bits, see alignment E=1.7e-155 PF00670: AdoHcyase_NAD" amino acids 194 to 376 (183 residues), 189.3 bits, see alignment E=5.5e-60

Best Hits

Swiss-Prot: 100% identical to SAHH_PSEP1: Adenosylhomocysteinase (ahcY) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 100% identity to ppf:Pput_4849)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWS3 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PP_4976 Adenosylhomocysteinase (Pseudomonas putida KT2440)
MPAGFTDYKVADISLAAWGRRETIIAESEMPALMGLRRKYLAEQPLKGAKILGCIHMTIQ
TAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTIL
KDGQPWDANMILDDGGDLTELLHKKYPQVLDRVHGVTEETTTGVHRLLDMLAKGELKVPA
INVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM
IVKVSEIDPICAMQACMDGFELVSPFIDGINDGTEASIDKALLGKIDLIVTTTGNVNVCD
ANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEVKPQVHKIHRTGAGSFDPQNDDYL
ILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIFLFEQKFADLPAEKKAERLTVEVLPK
KLDEEVALEMVRGFGGVVTQLTKQQADYIGVTVEGPFKPHAYRY