Protein Info for PP_4974 in Pseudomonas putida KT2440

Annotation: NhaP-type Na+/H+ and K+/H+ antiporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 406 (396 residues), 219.9 bits, see alignment E=2.6e-69

Best Hits

Swiss-Prot: 73% identical to NHAP_PSEAE: Na(+)/H(+) antiporter NhaP (nhaP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 99% identity to ppf:Pput_4847)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D53 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PP_4974 NhaP-type Na+/H+ and K+/H+ antiporters (Pseudomonas putida KT2440)
MLELVAAFICLTTLLTYVNYRFIGLPPAIGVMVTALLFSLILQGLSLVGFPGLEERVEGL
MNQIDFNDLLMHWMLAFLLFAGALHVNLSDLRSYRWPIGLLATLGVLIATVVIGYLAHWV
FALFGWQVPLIYCLLFGALISPTDPIAVLGALRTANAPKPLKTTIVGESLFNDGTAVVVF
TVLLGIIQLGETPSMADTAILFAREAIGGVVFGGLIGYATYRMIKSVEQYQVEVMLTLAL
VIGGSAMCYELHVSAPIAMVVAGLIIGNLGRNLAMNDMTRRYMDGFWELIDDMLNALLFA
LIGLELLLLPFNWMHLAAGGVLALAVLLSRLLTVAPAIVLLRRWRPVPKGTVRVLTWGGL
RGGVSVALALSLPLGEERDLLLSITYIVVLSSILVQGLSIGRVVRKVSAQP