Protein Info for PP_4966 in Pseudomonas putida KT2440

Annotation: transcriptional regulator of methionine metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF12840: HTH_20" amino acids 24 to 70 (47 residues), 35.1 bits, see alignment 4.3e-12 PF01022: HTH_5" amino acids 26 to 69 (44 residues), 29.7 bits, see alignment 1.9e-10 PF13489: Methyltransf_23" amino acids 149 to 297 (149 residues), 61.1 bits, see alignment E=4.6e-20 PF13847: Methyltransf_31" amino acids 164 to 270 (107 residues), 59 bits, see alignment E=1.8e-19 PF13649: Methyltransf_25" amino acids 169 to 259 (91 residues), 58.2 bits, see alignment E=4.4e-19 PF08241: Methyltransf_11" amino acids 169 to 262 (94 residues), 66.1 bits, see alignment E=1.5e-21 PF01209: Ubie_methyltran" amino acids 169 to 267 (99 residues), 32.6 bits, see alignment E=2.2e-11 PF08242: Methyltransf_12" amino acids 169 to 261 (93 residues), 54.8 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to ppu:PP_4966)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D61 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_4966 transcriptional regulator of methionine metabolism (Pseudomonas putida KT2440)
MNLRAQSIPEQRETLAALCKASGDALRLNVLRALANDSFGVLELAQIFDIGQSGMSHHLK
VLAQADLVATRREGNAIFYRRALPDGLRLGGRLHAALLEEVDDLALPPDVQARIAHVQQR
RAATSQDFFLRVEEKFRAQQDLIAGLPQYRDSLLALLDKLHFDPAASALEVGPGDGGFLP
DLARRFAQVTALDNSPTMLELARQVCQREGLDNVNLQLADALGATDVAADCVVLNMVLHH
FSDPALALRQLAKRVKAGGSLLVTELCSHDQGWAREACGDLWLGFEQDDLARWANAAGLA
HADSLYVGLRNGFQIQVRHFQRTAGDIHHR