Protein Info for PP_4936 in Pseudomonas putida KT2440

Annotation: O-antigen polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 205 to 221 (17 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 190 to 313 (124 residues), 64.3 bits, see alignment E=5.6e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4936)

Predicted SEED Role

"lipopolysaccharide core biosynthesis protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D91 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PP_4936 O-antigen polymerase (Pseudomonas putida KT2440)
MLYQKNWAQAWLGLGLVWFLAAIALAPSNKVYQQGLVLFLWLPTLVLAWSARGVLVQAWR
RQPALWGSVLLLLAWSGLSLAWSPAEEPMRELKRLLYILVFLLAFPLLAQLGQARIRQLL
LLGSALLAIAALVSIIKFYGVQRAPLLFRLAGIGEISHPILGAYVIGSALLLMLYEPPRR
RGLQLLWLAALACLGAFAMLSQSRGAVLALVITVVMAPLWFRDRHSRVFSVLALLATGLA
FLAVYDVIAQRGSSYRPEIFHAVVQMIAAHPWTGLGLGADYEVSAVGMHFDHTHNMFTHV
AVEMGLPGMLLWVMVWLFTLGEIVRARGTLFGKVLLGFWVYSTLAMQFDAASLTGTPRAE
WFISWLPVGLAMLLPWGRAENDACGKIAGST