Protein Info for PP_4934 in Pseudomonas putida KT2440

Annotation: heptose 7-phosphate kinase/heptose 1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR02198: bifunctional protein RfaE, domain I" amino acids 5 to 312 (308 residues), 410.4 bits, see alignment E=6.8e-127 PF00294: PfkB" amino acids 13 to 303 (291 residues), 161.6 bits, see alignment E=4.3e-51 PF08543: Phos_pyr_kin" amino acids 186 to 286 (101 residues), 35.7 bits, see alignment E=9.5e-13 TIGR02199: bifunctional protein RfaE, domain II" amino acids 331 to 472 (142 residues), 211.9 bits, see alignment E=5.1e-67 TIGR00125: cytidyltransferase-like domain" amino acids 341 to 407 (67 residues), 58.8 bits, see alignment E=7e-20 PF01467: CTP_transf_like" amino acids 343 to 437 (95 residues), 65.8 bits, see alignment E=7e-22

Best Hits

Swiss-Prot: 100% identical to HLDE_PSEPK: Bifunctional protein HldE (hldE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to ppu:PP_4934)

MetaCyc: 57% identical to fused heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-4342 [EC: 2.7.7.70]; RXN0-4341 [EC: 2.7.7.70, 2.7.1.167]

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.1.167 or 2.7.7.- or 2.7.7.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D93 at UniProt or InterPro

Protein Sequence (473 amino acids)

>PP_4934 heptose 7-phosphate kinase/heptose 1-phosphate adenylyltransferase (Pseudomonas putida KT2440)
MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIEDRPGGAANVALNI
AALGAPASLIGVTGQDEAADSLANSLQAAGVRSVFQRIAHQPTIVKLRVMSRHQQLLRID
FEEPFATDPLSLGAEVDSLLEGVKVLVLSDYGKGALKNHQNLIQAARAKGIPVLADPKGK
DFSIYRGASLITPNLSEFETIVGRCVDEAELVAKGLQLLQDLDLGALLVTRGEHGMTLLR
VGQPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVVGKLGTA
AISAPELRRAIQREEGSERGVLGLEQLLLAIDDARAHNEKIVFTNGCFDILHAGHVTYLE
QARAQGDRLIVAVNDDASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISFPEGTPENLL
SQVKPDVLVKGGDYGIDQVVGADIVKGYGGTVKVLGLVENSSTTAIVEKIRKN