Protein Info for PP_4912 in Pseudomonas putida KT2440

Annotation: DNA topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 12 to 744 (733 residues), 1143.9 bits, see alignment E=0 PF00521: DNA_topoisoIV" amino acids 36 to 472 (437 residues), 466.5 bits, see alignment E=8.7e-144 PF03989: DNA_gyraseA_C" amino acids 602 to 643 (42 residues), 17.7 bits, see alignment 1.9e-07 amino acids 649 to 689 (41 residues), 20.8 bits, see alignment 2.2e-08

Best Hits

Swiss-Prot: 88% identical to PARC_PSEAE: DNA topoisomerase 4 subunit A (parC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 100% identity to ppf:Pput_4788)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DB5 at UniProt or InterPro

Protein Sequence (752 amino acids)

>PP_4912 DNA topoisomerase IV subunit A (Pseudomonas putida KT2440)
MSDSLELSLDGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIVYAMSELG
LDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYTLVDGQGNWGAPDDPK
SFAAMRYTEARLSRYAEVLLSEVGQGTVDWVPNFDGTLQEPAVLPARLPNILLNGTTGIA
VGMATDVPPHNLREVASACVRLLDEPKATIEQLCEHIQGPDYPTEAEIVTPRAEILKMYE
SGRGSIRMRAVYRVEDGDIVVTALPHQVSGAKVLEQIAAQMQAKKLPMVADLRDESDHEN
PCRIVIIPRSNRVDVDELMQHLFATTDLESTYRVNVNIIGLDGRPQLKNLRTLLVEWLEF
RTNTVRRRLQHRLDKVEKRLHLLDGLLTAFLNLDEVIHIIRTEEYPKQALIERFELTEIQ
ADYILETRLRQLARLEEMKIRGEQDELLKEQAKLQALLGSEAKLRKLVRSELIKDAETYG
DDRRSPIVARAEAKALSENELMPTEPVTVVLSEKGWVRCAKGHDIDATGLSYKAGDGFKA
AAAGRSNQFAVLIDSTGRSYSLAAHSLPSARGQGEPLTGRLTPPPGATFECVLLPDDDAL
YVVASDAGYGFVVKGEDLQAKNKAGKGLLSLPNGAKVMTPRPVADREQDWLAAVTTEGRL
LVFKVSDLPQLGKGKGNKIIGVPGDRVASREEFVTDLAVIPEGATLVLQAGKRTLSLKAD
DLEHYKGERGRRGSKLPRGFQRVDGLQVEVPT