Protein Info for PP_4908 in Pseudomonas putida KT2440

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 196 to 218 (23 residues), see Phobius details TIGR00163: phosphatidylserine decarboxylase" amino acids 50 to 283 (234 residues), 258.4 bits, see alignment E=2.4e-81 PF02666: PS_Dcarbxylase" amino acids 63 to 282 (220 residues), 213.9 bits, see alignment E=9.3e-68

Best Hits

Swiss-Prot: 100% identical to PSD_PSEPK: Phosphatidylserine decarboxylase proenzyme (psd) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to ppf:Pput_4784)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DB9 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_4908 phosphatidylserine decarboxylase (Pseudomonas putida KT2440)
MKSRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTAWFAKRYQVNMSEALVEDLSAY
EHFNAFFTRALKPGARPLDETPGAILCPADGAVSQLGPIEHGRIFQAKGHGFSAQELLGG
DPAMAAPFMGGEFATIYLSPKDYHRVHMPLAGTLREMVYVPGRLFSVNQTTAENVPELFA
RNERVVCLFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKTFRYDEASRTPIHLE
KGAELGRFKLGSTAIVLFGPEQVKWAESLGAGSAVRMGQQLAAPAQA