Protein Info for PP_4882 in Pseudomonas putida KT2440

Annotation: Iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 278 to 305 (28 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 249 (165 residues), 59.4 bits, see alignment E=2.1e-20 amino acids 342 to 505 (164 residues), 46.1 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 44% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to ppu:PP_4882)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DE4 at UniProt or InterPro

Protein Sequence (521 amino acids)

>PP_4882 Iron ABC transporter, permease protein (Pseudomonas putida KT2440)
MTAALSEPVPVRFVPSRKRPSIWVVLPVLFLVAMSLLPLAYVAIKAWEAGWREALHLLWR
PFVWGLMRNTLLLMVGVTLTCMVVGLALAWLLERSNLAGRRLWGVVLCLPFAVPSFVSSF
TWVSLSSDFEGLGGAIMVMALSKYPLVFLPVAATLRNLDTSLEESARTLGCSRWGVFSKV
TLPLLWPSMLGGALLIALHMLVEFGALSILGLQTFTTAIYQQFELEFSNANAAMLSAVLL
AMCLAMLWLELRVRGKARHVRIGQGVARRAQPVRLRGWAVLAQLFCVGLAVLGSGIPLAM
LGYWLSVGSSAAFPVAAISKALFTSLSVSLGGAGFCVLLALPISFLVVRYKGRLAIWAER
LPYLLHALPGLVIALTLVFFALHYVPALYQTTALLLLAYALLFLPLAQSPVRTALNKASP
TLEEAARTLGASSFAAFCRVTLPIIFPAMAAAFALVFLDAMKELTATLLLSPTGMTTLAT
EVWAHTANVEFAAAAPYAALLIVVSGLPVYLLTTRMYLNKA