Protein Info for PP_4875 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 52 to 81 (30 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4756)

Predicted SEED Role

"FIG003573: hypothetical protein" in subsystem CBSS-262719.3.peg.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DF0 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_4875 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MRALASFIMRGRVQATLVVVISAVLPLLFWLSAAAGSLVLLRRGFKDATSVIAGGLLAGL
AVWVMGDPITFLVIAGALALAAMLRAEHPWSRVLLASAVFAVAFSLVLDLALAQTFDVLA
KAFAEAMPKIEGQPVLSGELIRPVLVASTAVTVQLFSVLALMLARYWQAALYNPGGFGRE
FRELKLPKQTMAVLVAVMVVAPFIGPQFIILASASSLVLVLAGIALMHGLVAQGRLAGFW
LVGMYVTLPLIMQLIYPLLMVLAIVDSLIDFRGRKSPPGKDSANGEG