Protein Info for PP_4869 in Pseudomonas putida KT2440

Annotation: NH(3)-dependent NAD(+) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF02540: NAD_synthase" amino acids 28 to 272 (245 residues), 210.7 bits, see alignment E=9.3e-67 TIGR00552: NAD+ synthetase" amino acids 33 to 272 (240 residues), 219.5 bits, see alignment E=2.1e-69

Best Hits

Swiss-Prot: 100% identical to NADE_PSEPK: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 99% identity to ppf:Pput_4747)

MetaCyc: 53% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DF6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PP_4869 NH(3)-dependent NAD(+) synthetase (Pseudomonas putida KT2440)
MQAVQQEIAQALKVQPPFADAAALEAEVARRVAFIKDCLANARLKTLVLGISGGVDSLTA
ALLAQRAINELRAETGDKAYTFIAVRLPYQVQHDEHDAQACLEVIKADEVHTVDIAPAVR
ALAAEVAALKNGSPTLVDFVVGNVKARTRMVAQYTIAGARAGLVIGTDHAAEAVMGFFTK
FGDGACDLAPLSGLVKNQVRAIARSFGAPESLVEKVPTADLEDLEPGKPDEASHGVTYAQ
IDAFLHGQPVDQAAFDIIVATYRKTQHKRELPFAP