Protein Info for PP_4868 in Pseudomonas putida KT2440

Annotation: Nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 11 to 399 (389 residues), 488.4 bits, E=8.7e-151
• PF17767: NAPRTase_N
  • amino acids 16 to 133 (118 residues), 114 bits, E=5.9e-37
• PF04095: NAPRTase
  • amino acids 173 to 399 (227 residues), 303.5 bits, E=1.3e-94

Best Hits

Swiss-Prot: 100% identical to PNCB_PSEPK: Nicotinate phosphoribosyltransferase (pncB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to ppu:PP_4868)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (4/7 steps found)
• NAD salvage pathway V (PNC V cycle) (2/5 steps found)
• NAD salvage (plants) (4/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (5/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

See Q88DF7 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PP_4868 Nicotinate phosphoribosyltransferase (Pseudomonas putida KT2440)
MMSESAFAERIVHNLLDTDFYKLTMMQGVLHNYPDADVEWEFRCRNGEDLRPYLGEIRNQ
LERLADLTLDDGQLAFLERISFLKPDFLRFLRLFRFNLRYVHVGIENDQLFLRLKGPWLH
VILFEVPLLAIISEVRNRNLHPHMRLAEARDQLYRKFDWLRAHASDDELAELQVADFGTR
RRFSSRVQEEVARVLRDDFPGRFVGTSNVDLAWKLDIKPLGTMAHEWIMAHQQLGPRLID
SQIAALDCWVREYRGLLGIALTDCITMDAFLGDFDLYFAKLFDGLRHDSGEPVAWAEKAI
AHYQKLGIDPMTKTLVFSDGLNLTRSLEIFRALRGRINVSFGIGTNLTCDIPGVAPMNIV
LKMTDCNGAPVAKISDEAAKTQCRDENFVAYMRHVFKVPSKE