Protein Info for PP_4857 in Pseudomonas putida KT2440

Annotation: uncharacterized protein YhjG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 637 to 657 (21 residues), see Phobius details PF05170: AsmA" amino acids 1 to 571 (571 residues), 519 bits, see alignment E=1.1e-159

Best Hits

Swiss-Prot: 54% identical to YHJG_ECOLI: AsmA family protein YhjG (yhjG) from Escherichia coli (strain K12)

KEGG orthology group: K07290, hypothetical protein (inferred from 100% identity to ppu:PP_4857)

Predicted SEED Role

"exported protein, conserved"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DG8 at UniProt or InterPro

Protein Sequence (688 amino acids)

>PP_4857 uncharacterized protein YhjG (Pseudomonas putida KT2440)
MTRPARILVWTLASLLTVLAILVVVIATFDWNRVKPLLNEKVSEALHRPFAINGNLAVHW
RTEPEEGGWRAWVPWPHFIAEDLTLGNPEWLKEPKMVGLERVEFRLAPLPLMFQQISIPR
INLTKPTASLTRLADGRANWVFDFGPKDENAEPSKWQLDIGAIGFDQGNVSFDDQTLKTS
MKVQIDPLGKPIPFSEIVGKASAEKAGGAQDYAFGLKAQGRYKGQPVSGTGKIGGLLALQ
DASQPFPLQADVRIADTHVVLAGTLTDPRNLGALDLRLRLSGASLGNLYPLTGVTLPDTP
AYSTDGHLRANLQAAQGASFNYQGFNGKIGDSDIHGDLAFVASQPRPKLSGNLVSNQLLF
KDLAPLIGADSNAEQKARGGASKQPAGKVLPVEAFRTERWRAMDADVTFAGKRIVHSAQL
PFTDLSAHVVLEDGLLRLEPLRFGVAGGSLASNIRLDGRSVPLQGRAKLTARGFKLKQLF
PTFAPMQTSFGELNGDADISGRGNSVAALLGTANGDLRMLINDGAISRSLMEIAGLNVGN
YVVGKLFGDEDVKINCAAADVGIKDGLATTRLFIFDTENAIIYIDGTANFASEQLDLNIT
PESKGLRLFSLRSPLYVRGPFAKPNAGVQALPLALRGAGMVALGVVAGPAAGLLALIAPS
SGDDPNQCTPLLQQMKAGKAPTAVKARK