Protein Info for PP_4838 in Pseudomonas putida KT2440

Annotation: Outer membrane copper receptor OprC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 58 to 160 (103 residues), 54.3 bits, see alignment E=1.7e-18 TIGR01778: TonB-dependent copper receptor" amino acids 61 to 688 (628 residues), 977.7 bits, see alignment E=1.6e-298 PF00593: TonB_dep_Rec_b-barrel" amino acids 212 to 646 (435 residues), 164.4 bits, see alignment E=8.8e-52

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_4838)

Predicted SEED Role

"outer membrane copper receptor OprC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DI7 at UniProt or InterPro

Protein Sequence (688 amino acids)

>PP_4838 Outer membrane copper receptor OprC (Pseudomonas putida KT2440)
MSGCTPVFALSLRGTIAALCGSLLAPMALAAGPGHEDHVHDAPELSPTVITAVAPSSPLT
VVTNPKDPRQPVPASDGADYLKTIPGFSAIRAGGTNGDPVLRGMFGSRLNILTNGGLMLG
ACPNRMDAPTSYISPETYDRLTVIKGPQSVIWGPGGSAGTILFEREPEKFGTLGSRVNAS
LLAGSNGRFDKVLDAAAGNSQGYARFVGNQSRSDDYHDGNKDTVPSRWEKWNGDVALGWT
PDQDTLLELTAGKGDGEARYAGRGMDGSQFKRESLGLRFEKSNLGEVLDKVEAQVYYNYA
DHVMDNYSLRTPSGSGMMGMPMVSNVDRRTMGARIKATWRWADVQLISGIDAQTNEHRQR
GGMGVDAHKGKAWTKDADFHNYGAFSELTWYVSGEDRLITGARLDRASARDFRTTSATEG
DTRADTLPSGFIRYEHDLAAIPATTYIGLGHAQRFPDYWELFSPKLAPPGAANAFDGIKP
EKTTQLDFGIQYRTERLEAWASGYVGQIRDYILFDYRTGMMGMSTSQAQNIDARIMGGEL
GAAYQLTDNWKADATLAYAWGKNSSDGKALPQMPPLESRLGLTYSRDVWSVGALWRLVAA
QNRIAENQGNVVGKDYDKSAGFGVFSLNGAYKVNNNLKLSAGVDNLFDKTYAEHLNLAGN
AGFGYPATDPQPVNEPGRTFWTKVDFSF