Protein Info for PP_4831 in Pseudomonas putida KT2440

Annotation: putative cobalt-precorrin-6A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01888: CbiD" amino acids 12 to 271 (260 residues), 299.3 bits, see alignment E=1e-93 TIGR00312: cobalamin biosynthesis protein CbiD" amino acids 19 to 320 (302 residues), 201.9 bits, see alignment E=6.3e-64

Best Hits

Swiss-Prot: 100% identical to CBID_PSEPK: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 100% identity to ppu:PP_4831)

MetaCyc: 36% identical to cobalt-precorrin-6A synthase (Salmonella enterica enterica serovar Typhimurium)
RXN-8764 [EC: 2.1.1.195]

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.195

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DJ4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PP_4831 putative cobalt-precorrin-6A synthase (Pseudomonas putida KT2440)
MREETREQPAPLRSGLTTGSCATATSLAAAKLLLTGQRNDAVDITLPKGKVVQMRLEFCR
LIGECAEAGTLKDAGDDPDVTHGALVYSQVRLLVEPGIGFVAGSGVGTVTRPGLVLAVGE
PAINPVPRRMISEHLQHLADACGYLGGFEVTVNVQGGEQLALKTMNPRLGILGGLSILGT
SGIVRPFSCAAYIASIHQGIDVAHTNGYTHIAACTGNASEDTMRRVYGLPEIALIEMGDF
VGAVLKHLRKVPVPRLTLCGGFGKISKLAAGHMDLHSRHSSIDLPQLAGWAADIGADEAL
QAAISGANTSQQALALAHAAGIALGDAVCAHALAFARSVVPAQVHVEVFAIDRQGGIVGQ
AGVQ